Register | Sign In


Understanding through Discussion


EvC Forum active members: 49 (9219 total)
5 online now:
Newest Member: KING IYK
Post Volume: Total: 920,765 Year: 1,087/6,935 Month: 368/719 Week: 10/146 Day: 10/23 Hour: 1/0


Thread  Details

Email This Thread
Newer Topic | Older Topic
  
Author Topic:   Can mutation and selection increase information?
Percy
Member
Posts: 23188
From: New Hampshire
Joined: 12-23-2000
Member Rating: 5.6


Message 196 of 222 (818552)
08-30-2017 9:09 AM
Reply to: Message 193 by CRR
08-30-2017 12:22 AM


Re: Cells
CRR writes:
However in this case the original cell has ALL of the genetic and extra-genetic information for EVERY cell including the information to switch off the un-needed functions in each specialist tissue. That is the difference between a complex organism and a single celled organism.
As I pointed out in another thread, the amoeba genome is a hundred times larger than the human genome. Which is more complex? You can't answer questions like that if you're going to avoid mathematics and information theory.
And are answers to those questions meaningful when all that's important is whether an organism is well adapted to its environment? How would you mathematically measure how well adapted an organism is? If you could do that you could then compare level of adaptation to complexity or amount of information and see if there are any meaningful correlations.
My guess is that there would be little correlation. Evolution is a random walk. Solutions to the adaptation problems faced by organisms in their environment are presented through allele frequency change and random mutation. Evolution makes do with what is available. How much genome an organism ended up with to achieve adaptation is probably random, though perhaps it may serve as a record of how much environmental change its ancestral species have passed through.
--Percy
Edited by Percy, : Typo.

This message is a reply to:
 Message 193 by CRR, posted 08-30-2017 12:22 AM CRR has replied

Replies to this message:
 Message 198 by CRR, posted 08-30-2017 6:15 PM Percy has replied
 Message 199 by Faith, posted 08-30-2017 6:18 PM Percy has seen this message but not replied

  
Taq
Member
Posts: 10385
Joined: 03-06-2009
Member Rating: 5.8


Message 197 of 222 (818559)
08-30-2017 10:56 AM
Reply to: Message 193 by CRR
08-30-2017 12:22 AM


Re: Cells
CRR writes:
However in this case the original cell has ALL of the genetic and extra-genetic information for EVERY cell including the information to switch off the un-needed functions in each specialist tissue. That is the difference between a complex organism and a single celled organism.
I would agree that the production of tissues is what separates complex eukaryotes (animals, plants) from less complex species (protists, prokaryotes). It comes down to the evolution of switches in the genome that respond to chemicals released by neighboring cells. It is interesting to note that complex animals share some of the more important switches which are called homeobox genes.

This message is a reply to:
 Message 193 by CRR, posted 08-30-2017 12:22 AM CRR has seen this message but not replied

  
CRR
Member (Idle past 2567 days)
Posts: 579
From: Australia
Joined: 10-19-2016


Message 198 of 222 (818584)
08-30-2017 6:15 PM
Reply to: Message 196 by Percy
08-30-2017 9:09 AM


Re: Cells
Percy writes:
the amoeba genome is a hundred times larger than the human genome
Over 200 times in the case of Amoeba dubia.
My conclusion is that size is not a good measure of information content. I have found that with books. You can't determine the value of the content by weighing a book or by doing a word count.

This message is a reply to:
 Message 196 by Percy, posted 08-30-2017 9:09 AM Percy has replied

Replies to this message:
 Message 200 by Tangle, posted 08-31-2017 3:02 AM CRR has not replied
 Message 201 by Percy, posted 08-31-2017 8:39 AM CRR has replied
 Message 202 by Taq, posted 08-31-2017 10:38 AM CRR has replied

  
Faith 
Suspended Member (Idle past 1769 days)
Posts: 35298
From: Nevada, USA
Joined: 10-06-2001


Message 199 of 222 (818586)
08-30-2017 6:18 PM
Reply to: Message 196 by Percy
08-30-2017 9:09 AM


Re: Cells
Just curious: How much junk DNA is there in that amoeba genome?

This message is a reply to:
 Message 196 by Percy, posted 08-30-2017 9:09 AM Percy has seen this message but not replied

  
Tangle
Member
Posts: 9634
From: UK
Joined: 10-07-2011
Member Rating: 5.4


Message 200 of 222 (818606)
08-31-2017 3:02 AM
Reply to: Message 198 by CRR
08-30-2017 6:15 PM


Re: Cells
CRR writes:
Over 200 times in the case of Amoeba dubia.
My conclusion is that size is not a good measure of information content. I have found that with books. You can't determine the value of the content by weighing a book or by doing a word count.
My conclusion is that the amoeba's genome is EXACTLY the size it needs to be for an amoeba. It containly precicely the correct amount (and value???) of informtion to be an amoeba.
How much 'value' or 'information' do you think can you remove from an amoeba's genome before it's no longer viable?

Je suis Charlie. Je suis Ahmed. Je suis Juif. Je suis Parisien. I am Mancunian. I am Brum. I am London.I am Finland. Soy Barcelona
"Life, don't talk to me about life" - Marvin the Paranoid Android
"Science adjusts it's views based on what's observed.
Faith is the denial of observation so that Belief can be preserved."
- Tim Minchin, in his beat poem, Storm.

This message is a reply to:
 Message 198 by CRR, posted 08-30-2017 6:15 PM CRR has not replied

  
Percy
Member
Posts: 23188
From: New Hampshire
Joined: 12-23-2000
Member Rating: 5.6


(1)
Message 201 of 222 (818611)
08-31-2017 8:39 AM
Reply to: Message 198 by CRR
08-30-2017 6:15 PM


Re: Cells
CRR writes:
My conclusion is that size is not a good measure of information content. I have found that with books. You can't determine the value of the content by weighing a book or by doing a word count.
You're still confusing information with meaning, and you still have accepted no way of measuring information (Gitt cannot measure information). Therefore your statements about information gain or loss are meaningless.
--Percy

This message is a reply to:
 Message 198 by CRR, posted 08-30-2017 6:15 PM CRR has replied

Replies to this message:
 Message 208 by CRR, posted 08-31-2017 7:24 PM Percy has replied

  
Taq
Member
Posts: 10385
Joined: 03-06-2009
Member Rating: 5.8


Message 202 of 222 (818622)
08-31-2017 10:38 AM
Reply to: Message 198 by CRR
08-30-2017 6:15 PM


Re: Cells
CRR writes:
My conclusion is that size is not a good measure of information content. I have found that with books. You can't determine the value of the content by weighing a book or by doing a word count.
If you found the following sequence in a book, would you think that it contained information?
MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIW
GEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE

This message is a reply to:
 Message 198 by CRR, posted 08-30-2017 6:15 PM CRR has replied

Replies to this message:
 Message 203 by jar, posted 08-31-2017 11:09 AM Taq has not replied
 Message 209 by CRR, posted 08-31-2017 7:26 PM Taq has replied

  
jar
Member (Idle past 164 days)
Posts: 34140
From: Texas!!
Joined: 04-20-2004


Message 203 of 222 (818623)
08-31-2017 11:09 AM
Reply to: Message 202 by Taq
08-31-2017 10:38 AM


Re: Cells
Bsgra jung frrzf tvoorevfu vf npghnyyl dhvgr vasbezngvir. Vmalu doha zlltz npiilypzo pz hjabhssf xbpal pumvythapcl. Tkyjs bmfy xjjrx lnggjwnxm nx fhyzfqqd vznyj nsktwrfynaj.

My Sister's Website: Rose Hill Studios My Website: My Website

This message is a reply to:
 Message 202 by Taq, posted 08-31-2017 10:38 AM Taq has not replied

Replies to this message:
 Message 204 by Percy, posted 08-31-2017 1:14 PM jar has replied

  
Percy
Member
Posts: 23188
From: New Hampshire
Joined: 12-23-2000
Member Rating: 5.6


Message 204 of 222 (818639)
08-31-2017 1:14 PM
Reply to: Message 203 by jar
08-31-2017 11:09 AM


Re: Cells
Sfqfujujpo jt zpvs gsjfoe.
--Qfsdz

This message is a reply to:
 Message 203 by jar, posted 08-31-2017 11:09 AM jar has replied

Replies to this message:
 Message 205 by ringo, posted 08-31-2017 1:20 PM Percy has replied
 Message 207 by jar, posted 08-31-2017 3:11 PM Percy has seen this message but not replied

  
ringo
Member (Idle past 737 days)
Posts: 20940
From: frozen wasteland
Joined: 03-23-2005


Message 205 of 222 (818640)
08-31-2017 1:20 PM
Reply to: Message 204 by Percy
08-31-2017 1:14 PM


Re: Cells
Uif lfzxpse jt Qfsdz.

This message is a reply to:
 Message 204 by Percy, posted 08-31-2017 1:14 PM Percy has replied

Replies to this message:
 Message 206 by Percy, posted 08-31-2017 1:40 PM ringo has seen this message but not replied

  
Percy
Member
Posts: 23188
From: New Hampshire
Joined: 12-23-2000
Member Rating: 5.6


(1)
Message 206 of 222 (818642)
08-31-2017 1:40 PM
Reply to: Message 205 by ringo
08-31-2017 1:20 PM


Re: Cells
Uibu'mm ufbdi nf up vtf nz sfbm obnf.
--Nyzaquml

This message is a reply to:
 Message 205 by ringo, posted 08-31-2017 1:20 PM ringo has seen this message but not replied

  
jar
Member (Idle past 164 days)
Posts: 34140
From: Texas!!
Joined: 04-20-2004


Message 207 of 222 (818645)
08-31-2017 3:11 PM
Reply to: Message 204 by Percy
08-31-2017 1:14 PM


Re: Cells
Exactly. But still, no one has presented the working definition of information, how to recognize information or how to determine increase in information. In my example there are actually at least four significant, definable, detectable and applicable bits of information and your post added two more.

My Sister's Website: Rose Hill Studios My Website: My Website

This message is a reply to:
 Message 204 by Percy, posted 08-31-2017 1:14 PM Percy has seen this message but not replied

Replies to this message:
 Message 211 by CRR, posted 08-31-2017 8:25 PM jar has not replied

  
CRR
Member (Idle past 2567 days)
Posts: 579
From: Australia
Joined: 10-19-2016


Message 208 of 222 (818665)
08-31-2017 7:24 PM
Reply to: Message 201 by Percy
08-31-2017 8:39 AM


Re: Information
You're still confusing Shannon Information with Information. Shannon Information is only a metric for a message.
See Information - Wikipedia
Information is that which informs, so it will have meaning.

This message is a reply to:
 Message 201 by Percy, posted 08-31-2017 8:39 AM Percy has replied

Replies to this message:
 Message 212 by Percy, posted 08-31-2017 8:39 PM CRR has not replied

  
CRR
Member (Idle past 2567 days)
Posts: 579
From: Australia
Joined: 10-19-2016


(1)
Message 209 of 222 (818667)
08-31-2017 7:26 PM
Reply to: Message 202 by Taq
08-31-2017 10:38 AM


Re: Cells
Lorem ipsum dolor sit amet, consectetur adipiscing elit, sed do eiusmod tempor incididunt ut labore et dolore magna aliqua. Ut enim ad minim veniam, quis nostrud exercitation ullamco laboris nisi ut aliquip ex ea commodo consequat. Duis aute irure dolor in reprehenderit in voluptate velit esse cillum dolore eu fugiat nulla pariatur. Excepteur sint occaecat cupidatat non proident, sunt in culpa qui officia deserunt mollit anim id est laborum.

This message is a reply to:
 Message 202 by Taq, posted 08-31-2017 10:38 AM Taq has replied

Replies to this message:
 Message 210 by Taq, posted 08-31-2017 8:00 PM CRR has not replied

  
Taq
Member
Posts: 10385
Joined: 03-06-2009
Member Rating: 5.8


Message 210 of 222 (818669)
08-31-2017 8:00 PM
Reply to: Message 209 by CRR
08-31-2017 7:26 PM


Re: Cells
A simple answer to my question would be most appreciated.

This message is a reply to:
 Message 209 by CRR, posted 08-31-2017 7:26 PM CRR has not replied

  
Newer Topic | Older Topic
Jump to:


Copyright 2001-2023 by EvC Forum, All Rights Reserved

™ Version 4.2
Innovative software from Qwixotic © 2025